PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013595579.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 315aa    MW: 34645.6 Da    PI: 5.1223
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013595579.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.88.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l  + +++G g W+t +++ g++R++k+c++rw +yl
   XP_013595579.1 14 KGAWTPEEDQKLTAYLQLHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding49.59.6e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T+eE++ +++++++ G++ W++Ia ++  gRt++++k++w++ 
   XP_013595579.1  67 RGEFTPEEEDTIIKLHALKGNK-WAAIATCLA-GRTDNEIKNYWNTN 111
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.816961IPR017930Myb domain
SuperFamilySSF466891.54E-2811108IPR009057Homeodomain-like
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002499.9E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-231568IPR009057Homeodomain-like
CDDcd001671.19E-91661No hitNo description
PROSITE profilePS5129423.72562116IPR017930Myb domain
SMARTSM007174.4E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2569117IPR009057Homeodomain-like
CDDcd001677.30E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000162Biological Processtryptophan biosynthetic process
GO:0002213Biological Processdefense response to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0009759Biological Processindole glucosinolate biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MVRTPCCKEE GIKKGAWTPE EDQKLTAYLQ LHGEGGWRTL PEKAGLKRCG KSCRLRWANY  60
LRPDIKRGEF TPEEEDTIIK LHALKGNKWA AIATCLAGRT DNEIKNYWNT NLKKRLKQKG  120
IDPTAHKPIN STDQTGSEPK HHKLGSSGSA RLLNRVASKY SVDSNRDLLT GIIIGNSTNI  180
ADVSQSSGDV DSPTKNSTST LLNQMAAASS GFISIQNNTS TSPGFSDNCS FSDGFTEFFS  240
NDEISGMYTN VDNVGLMEEL KDILSYGGAD VGDIKDSPEV NVTDDMDFLD SWNKEDDLDL  300
EKFVSSLDSK IGVFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141167108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKRLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7026950.0AB702695.1 Brassica oleracea var. viridis mRNA for Myb domain protein 34 (BoMyb34), complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013595579.10.0PREDICTED: transcription factor MYB34-like
RefseqXP_013595580.10.0PREDICTED: transcription factor MYB34-like
SwissprotO643991e-161MYB34_ARATH; Transcription factor MYB34
TrEMBLA0A0D3DDG00.0A0A0D3DDG0_BRAOL; Uncharacterized protein
STRINGBra013000.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93311637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60890.11e-162myb domain protein 34